PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_C964675DE.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 126aa    MW: 14620.9 Da    PI: 10.3097
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_C964675DE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l+ +++q G g+W++ +++ g+ R++k+c++rw +yl
  Traes_2DL_C964675DE.1 14 KGPWTPEEDQKLLSYIEQQGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding55.51.3e-1767112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Traes_2DL_C964675DE.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-26564IPR009057Homeodomain-like
PROSITE profilePS5129416.81961IPR017930Myb domain
SuperFamilySSF466893.41E-3011108IPR009057Homeodomain-like
SMARTSM007176.4E-131363IPR001005SANT/Myb domain
PfamPF002494.8E-161461IPR001005SANT/Myb domain
CDDcd001674.32E-101661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-2765116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002496.8E-1767112IPR001005SANT/Myb domain
CDDcd001673.42E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLSYIE QQGHGCWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519180.0JF951918.1 Triticum aestivum clone TaMYB16 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579906.11e-91PREDICTED: myb-related protein Myb4-like
SwissprotQ8GWP03e-68MYB39_ARATH; Transcription factor MYB39
TrEMBLG9DR811e-92G9DR81_WHEAT; R2R3-MYB protein
STRINGBRADI5G12417.14e-91(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.22e-86myb domain protein 16
Publications ? help Back to Top
  1. Zhang L,Zhao G,Jia J,Liu X,Kong X
    Molecular characterization of 60 isolated wheat MYB genes and analysis of their expression during abiotic stress.
    J. Exp. Bot., 2012. 63(1): p. 203-14
    [PMID:21934119]